PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF041800040CFD_t1
Common NameTRAES_3BF041800040CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 163aa    MW: 17744.9 Da    PI: 6.2674
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF041800040CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.24.8e-5815111197
                    NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                              vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+yv+plk+y
  TRAES3BF041800040CFD_t1  15 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYVDPLKIY 100
                              69************************************************************************************ PP

                    NF-YB  87 lkkyrelegek 97 
                              l+kyr++eg++
  TRAES3BF041800040CFD_t1 101 LQKYRDMEGDS 111
                              *********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.0E-5414120IPR009072Histone-fold
SuperFamilySSF471135.74E-4018117IPR009072Histone-fold
PfamPF008081.2E-282185IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.3E-224967No hitNo description
PROSITE patternPS0068505268IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.3E-226886No hitNo description
PRINTSPR006153.3E-2287105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MADDDSGSPR GGGGVREQDR FLPIANISRI MKKAVPANGK IAKDAKETLQ ECVSEFISFV  60
TSEASDKCQK EKRKTINGDD LLWAMATLGF EEYVDPLKIY LQKYRDMEGD SKLTSKSGEG  120
SVKKDIIGAH SGATSSNAQA MVQHGAYAQG MGYMQPQYHN GDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B2e-4814106294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4814106294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0093930.0BT009393.1 Triticum aestivum clone wlm96.pk037.k9:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232523.11e-106PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_003564550.11e-106PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotQ5QMG33e-93NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2
TrEMBLA0A077S2001e-120A0A077S200_WHEAT; Uncharacterized protein
STRINGMLOC_72428.41e-111(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.16e-70nuclear factor Y, subunit B10
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]